Produkt Dodany do Koszyka
x

-------- czy (albo) --------

PLN
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Polski
ANG ANG
0,00 zł
Rolki

Szeroki wybór rolek fitness, rekreacyjnych, freestylowych, dziecięcych - regulowanych i do gry w hokeja na rolkach.

Rolki
Fitness Freestyle, urban 3 whells Dziecięce - regulowane Hokejowe in-line
Rolki freestyle FR Skates FR1 80 black roz. 46
Rolki freestyle FR Skates FR1 80 black roz. 46
899,00 zł
Rolki freestyle FR Skates FR2 80 roz. 36
Rolki freestyle FR Skates FR2 80 roz. 36
599,00 zł
Rolki freestyle FR Skates FR3 80 black
Rolki freestyle FR Skates FR3 80 black
799,00 zł
Rolki freestyle FR Skates FR3 80 black/white
Rolki freestyle FR Skates FR3 80 black/white
799,00 zł
Rolki freestyle FR Skates FR3 80 roz. 36
Rolki freestyle FR Skates FR3 80 roz. 36
499,00 zł
Rolki freestyle FR Skates FRX 310
Rolki freestyle FR Skates FRX 310
749,00 zł
Rolki freestyle FR Skates FRX 310
Rolki freestyle FR Skates FRX 310
749,00 zł
Rolki freestyle FR Skates FRX 80 black
Rolki freestyle FR Skates FRX 80 black
599,00 zł
Rolki freestyle FR Skates FRX 80 orange
Rolki freestyle FR Skates FRX 80 orange
599,00 zł
Rolki freestyle FR Skates FRXP 80
Rolki freestyle FR Skates FRXP 80
699,00 zł
Rolki freestyle Seba FR1 80 black
Rolki freestyle Seba FR1 80 black
699,00 zł
Rolki freestyle Seba FR1 80 grey
Rolki freestyle Seba FR1 80 grey
699,00 zł
Rolki freestyle Seba FR1 80 white
Rolki freestyle Seba FR1 80 white
699,00 zł
Rolki freestyle Seba FR3 80 roz. 35 i 36
Rolki freestyle Seba FR3 80 roz. 35 i 36
499,00 zł
Rolki freestyle Seba FRW 80 roz. 35
Rolki freestyle Seba FRW 80 roz. 35
399,00 zł
Rolki freestyle Seba FRX 80 roz. 35
Rolki freestyle Seba FRX 80 roz. 35
399,00 zł
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i
Withdraw from contract