Produkt Dodany do Koszyka
x

-------- czy (albo) --------

PLN
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Polski
ANG ANG
0,00 zł
Freestyle, urban
Freestyle, urban
Rolki freestyle Rollerblade RB Pro X 80
Rolki freestyle Rollerblade RB Pro X 80
799,00 zł
Rolki freestyle FR Skates FRXP 80
Rolki freestyle FR Skates FRXP 80
699,00 zł
Rolki freestyle FR Skates FRX 80
Rolki freestyle FR Skates FRX 80
599,00 zł
Rolki freestyle FR Skates FRX 80
Rolki freestyle FR Skates FRX 80
599,00 zł
Rolki freestyle dziecięce FR Skates FRJ 32-34
Rolki freestyle dziecięce FR Skates FRJ 32-34
549,00 zł
Rolki freestyle dziecięce FR Skates FRJ 32-34
Rolki freestyle dziecięce FR Skates FRJ 32-34
549,00 zł
Rolki freestyle dziecięce FR Skates FRJ 32-34
Rolki freestyle dziecięce FR Skates FRJ 32-34
549,00 zł
Rolki freestyle Seba E3 80 Premium
Rolki freestyle Seba E3 80 Premium
449,00 zł
Rolki freestyle Seba E3 80
Rolki freestyle Seba E3 80
399,00 zł
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i